1TSKCOMAlso, thou son of man, prophesy unto the mountains of Israel, and say, Ye mountains of Israel, hear the word of the LORD:1TSKCOMനീയോ, മനുഷ്യപുത്രാ, യിസ്രായേൽപർവ്വതങ്ങളോടു പ്രവചിച്ചുപറയേണ്ടതു: യിസ്രായേൽപർവ്വതങ്ങളേ, യഹോവയുടെ വചനം കേൾപ്പിൻ!1TSKCOMNeeyo, manushyaputhraa, yisraayelparvvathangalotu pravachichuparayendathu: yisraayelparvvathangale, yahovayute vachanam kelppin!1TSKCOMफिर हे मनुष्य के सन्तान, तू इस्राएल के पहाड़ोंसे भविष्यद्वाणी करके कह, हे इस्राएल के पहाड़ो, यहोवा का वचन सुनो।2TSKCOMThus saith the Lord GOD; Because the enemy hath said against you, Aha, even the ancient high places are ours in possession:2TSKCOMയഹോവയായ കർത്താവു ഇപ്രകാരം അരുളിച്ചെയ്യുന്നു: ശത്രു നിങ്ങളെക്കുറിച്ചു: നന്നായി; പുരാതനഗിരികൾ ഞങ്ങൾക്കു കൈവശം ആയിരിക്കുന്നു എന്നു പറയുന്നു.2TSKCOMYahovayaaya karthaavu iprakaaram arulicheyyunnu: shathru ningalekkurichu: nannaayi; puraathanagirikal njangalkku kaivasham aayirikkunnu ennu parayunnu.2TSKCOMपरमेश्वर यहोवा योंकहता है, शत्रु ने तो तुम्हारे विषय में कहा है, आहा ! प्राचीनकाल के ऊंचे स्यान अब हमारे अधिक्कारने में आ गए।3TSKCOMTherefore prophesy and say, Thus saith the Lord GOD; Because they have made you desolate, and swallowed you up on every side, that ye might be a possession unto the residue of the heathen, and ye are taken up in the lips of talkers, and are an infamy of the people:3TSKCOMഅതുകൊണ്ടു നീ പ്രവചിച്ചുപറയേണ്ടതു: യഹോവയായ കർത്താവു ഇപ്രകാരം അരുളിച്ചെയ്യുന്നു: നിങ്ങൾ ജാതികളിൽ ശേഷിച്ചവർക്കു കൈവശമായിത്തീരത്തക്കവണ്ണം അവർ നിങ്ങളെ ശൂന്യമാക്കി നിങ്ങളെ ചുറ്റും നിന്നു കപ്പിക്കളയുന്നതുകൊണ്ടും നിങ്ങൾ വായാളികളുടെ അധരങ്ങളിൽ അകപ്പെട്ടു ലോകരുടെ അപവാദവിഷയമായിത്തീർന്നിരിക്കകൊണ്ടും യിസ്രായേൽപർവ്വതങ്ങളേ,3TSKCOMAthukontu nee pravachichuparayendathu: yahovayaaya karthaavu iprakaaram arulicheyyunnu: ningal jaathikalil sheshichavarkku kaivashamaayitheerathakkavannam avar ningale shoonyamaakki ningale churrum ninnu kappikkalayunnathukontum ningal vaayaalikalute adharangalil akappettu lokarute apavaadavishayamaayitheernnirikkakontum yisraayelparvvathangale,3TSKCOMइस कारण भविष्यद्वाणी करके कह, परमेश्वर यहोवा योंकहता हे, लोगोंने जो तुम्हें उजाड़ा और चारोंओर से तुम्हें ऐसा निगल लिया कि तुम बची हुई जातियोंका अधिक्कारने हो जाओ, और लुतरे तुम्हारी चर्चा करते और साधारण लोग तुम्हारी निन्दा करते हैं;4TSKCOMTherefore, ye mountains of Israel, hear the word of the Lord GOD; Thus saith the Lord GOD to the mountains, and to the hills, to the rivers, and to the valleys, to the desolate wastes, and to the cities that are forsaken, which became a prey and derision to the residue of the heathen that are round about;4TSKCOMയഹോവയായ കർത്താവിന്റെ വചനം കേൾപ്പിൻ! മലകളോടും കുന്നുകളോടും തോടുകളോടും താഴ്വരകളോടും പാഴായിരിക്കുന്ന ശൂന്യപ്രദേശങ്ങളോടും നിർജ്ജനവും ചുറ്റുമുള്ള ജാതികളിൽ ശേഷിച്ചവർക്കു കവർച്ചയും പരിഹാസവും ആയി ഭവിച്ചിരിക്കുന്ന പട്ടണങ്ങളോടും യഹോവയായ കർത്താവു ഇപ്രകാരം അരുളിച്ചെയ്യുന്നു:4TSKCOMYahovayaaya karthaavinre vachanam kelppin! malakalotum kunnukalotum thotukalotum thaazhvarakalotum paazhaayirikkunna shoonyapradeshangalotum nirjjanavum churrumulla jaathikalil sheshichavarkku kavarchayum parihaasavum aayi bhavichirikkunna pattanangalotum yahovayaaya karthaavu iprakaaram arulicheyyunnu:4TSKCOMइस कारण, हे इस्राएल के पहाड़ो, परमेश्वर यहोवा का वचन सुनो, परमेश्वर यहोवा तुम से योंकहता है, अर्यात् पहाड़ोंऔर पहाडिय़ोंसे और नालोंऔर तराइयोंसे, और उजड़े हुए खण्डहरोंऔर निर्जन नगरोंसे जो चारोंओर की बची हुई जातियोंसे लुट गए और उनके हंसने के कारण हो गए हैं;5TSKCOMTherefore thus saith the Lord GOD; Surely in the fire of my jealousy have I spoken against the residue of the heathen, and against all Idumea, which have appointed my land into their possession with the joy of all their heart, with despiteful minds, to cast it out for a prey.5TSKCOMഅതുകൊണ്ടു യഹോവയായ കർത്താവു ഇപ്രകാരം അരുളിച്ചെയ്യുന്നു: ജാതികളിൽ ശേഷിച്ചവരോടും എല്ലാ ഏദോമിനോടും ഞാൻ നിശ്ചയമായി എന്റെ തീക്ഷ്ണതാഗ്നിയോടെ സംസാരിക്കും; അവർ എന്റെ ദേശത്തെ കവർച്ചക്കായി തള്ളിക്കളവാൻ തക്കവണ്ണം അതിനെ പൂർണ്ണഹൃദയസന്തോഷത്തോടും നിന്ദാഭാവത്തോടും കൂടെ തങ്ങൾക്കു അവകാശമായി നിയമിച്ചുവല്ലോ.5TSKCOMAthukontu yahovayaaya karthaavu iprakaaram arulicheyyunnu: jaathikalil sheshichavarotum ellaa edominotum njaan nishchayamaayi enre theekshnathaagniyote samsaarikkum; avar enre deshathe kavarchakkaayi thallikkalavaan thakkavannam athine poornnahridayasanthoshathotum nindaabhaavathotum koote thangalkku avakaashamaayi niyamichuvallo.5TSKCOMपरमेश्वर यहोवा योंकहता है, निश्चय मैं ने अपक्की जलन की आग में बची हुई जातियोंके और सारे एदोम के विरुद्ध में कहा है कि जिन्होंने मेरे देश को अपके मन के पूरे आनन्द और अभिमान से अपके अधिक्कारने में किया है कि वह पराया होकर लूटा जाए।6TSKCOMProphesy therefore concerning the land of Israel, and say unto the mountains, and to the hills, to the rivers, and to the valleys, Thus saith the Lord GOD; Behold, I have spoken in my jealousy and in my fury, because ye have borne the shame of the heathen:6TSKCOMഅതുകൊണ്ടു നീ യിസ്രായേൽ ദേശത്തെക്കുറിച്ചു പ്രവചിച്ചു മലകളോടും കുന്നുകളോടും തോടുകളോടും താഴ്വരകളോടും പറയേണ്ടതു: യഹോവയായ കർത്താവു ഇപ്രകാരം അരുളിച്ചെയ്യുന്നു: നിങ്ങൾ ജാതികളുടെ നിന്ദയെ വഹിച്ചതുകൊണ്ടു ഞാൻ എന്റെ തീക്ഷ്ണതയോടും എന്റെ ക്രോധത്തോടും കൂടെ സംസാരിക്കുന്നു.6TSKCOMAthukontu nee yisraayel deshathekkurichu pravachichu malakalotum kunnukalotum thotukalotum thaazhvarakalotum parayendathu: yahovayaaya karthaavu iprakaaram arulicheyyunnu: ningal jaathikalute nindaye vahichathukontu njaan enre theekshnathayotum enre krodhathotum koote samsaarikkunnu.6TSKCOMइस कारण इस्राएल के देश के विषय में भविष्यद्वाणी करके पहाड़ों, पहाडिय़ों, नालों, और तराइयोंसे कह, परमेश्वर यहोवा योंकहता है, देखो, तुम ने जातियोंकी निन्दा सही है, इस कारण मैं अपक्की बड़ी जलजलाहट से बोला हूँ।7TSKCOMTherefore thus saith the Lord GOD; I have lifted up mine hand, Surely the heathen that are about you, they shall bear their shame.7TSKCOMഅതുകൊണ്ടു യഹോവയായ കർത്താവു ഇപ്രകാരം അരുളിച്ചെയ്യുന്നു: നിങ്ങളുടെ ചുറ്റുമുള്ള ജാതികൾ നിശ്ചയമായി തങ്ങളുടെ ലജ്ജ വഹിക്കും എന്നു ഞാൻ കൈ ഉയർത്തി സത്യം ചെയ്യുന്നു.7TSKCOMAthukontu yahovayaaya karthaavu iprakaaram arulicheyyunnu: ningalute churrumulla jaathikal nishchayamaayi thangalute lajja vahikkum ennu njaan kai uyarthi sathyam cheyyunnu.7TSKCOMपरमेश्वर यहोवा योंकहता है, मैं ने यह शपय खाई है कि नि:सन्देह तुम्हारे चारोंओर जो जातियां हैं, उनको अपक्की निन्दा आप ही सहनी पकेगी।8TSKCOMBut ye, O mountains of Israel, ye shall shoot forth your branches, and yield your fruit to my people of Israel; for they are at hand to come.8TSKCOMനിങ്ങളോ, യിസ്രായേൽപർവ്വതങ്ങളേ, എന്റെ ജനമായ യിസ്രായേൽ വരുവാൻ അടുത്തിരിക്കകൊണ്ടു കൊമ്പുകളെ നീട്ടി അവർക്കു വേണ്ടി ഫലം കായ്പിൻ.8TSKCOMNingalo, yisraayelparvvathangale, enre janamaaya yisraayel varuvaan atuthirikkakontu kompukale neetti avarkku venti phalam kaaypin.8TSKCOMपरन्तु, हे इस्राएल के पहाड़ो, तुम पर डालियां पनपेंगी और उनके फल मेरी प्रजा इस्राएल के लिथे लगेंगे; क्योंकि उसका लौट आना निकट है।9TSKCOMFor, behold, I am for you, and I will turn unto you, and ye shall be tilled and sown:9TSKCOMഞാൻ നിങ്ങൾക്കു അനുകൂലമായിരിക്കുന്നു; ഞാൻ നിങ്ങളുടെ അടുക്കലേക്കു തിരിയും; നിങ്ങളിൽ കൃഷിയും വിതയും നടക്കും.9TSKCOMNjaan ningalkku anukoolamaayirikkunnu; njaan ningalute atukkalekku thiriyum; ningalil krishiyum vithayum natakkum.9TSKCOMऔर देखो, मैं तुम्हारे पझ में हूँ, और तुम्हारी ओर कृपादृष्टि करूंगा, और तुम जोते-बोए जाओगे;10TSKCOMAnd I will multiply men upon you, all the house of Israel, even all of it: and the cities shall be inhabited, and the wastes shall be builded:10TSKCOMഞാൻ നിങ്ങളിൽ മനുഷ്യരെ, യിസ്രായേൽഗൃഹം മുഴുവനെയും തന്നേ, വർദ്ധിപ്പിക്കും; പട്ടണങ്ങളിൽ നിവാസികൾ ഉണ്ടാകും; ശൂന്യപ്രദേശങ്ങളെയും പണിയും.10TSKCOMNjaan ningalil manushyare, yisraayelgriham muzhuvaneyum thanne, vardhippikkum; pattanangalil nivaasikal undaakum; shoonyapradeshangaleyum paniyum.10TSKCOMऔर मैं तुम पर बहुत मनुष्य अर्यात् इस्राएल के सारे घराने को बसाऊंगा; और नगर फिर बसाए और खण्डहर फिर बनाएं जाएंगे।11TSKCOMAnd I will multiply upon you man and beast; and they shall increase and bring fruit: and I will settle you after your old estates, and will do better unto you than at your beginnings: and ye shall know that I am the LORD.11TSKCOMഞാൻ നിങ്ങളിൽ മനുഷ്യരെയും മൃഗങ്ങളെയും വർദ്ധിപ്പിക്കും; അവർ പെരുകി സന്താനപുഷ്ടിയുള്ളവരാകും; ഞാൻ നിങ്ങളിൽ പണ്ടത്തെപ്പോലെ ആളെ പാർപ്പിക്കും; നിങ്ങളുടെ ആദികാലത്തുണ്ടായിരുന്നതിനെക്കാൾ അധികം നന്മ ഞാൻ നിങ്ങൾക്കു ചെയ്യും; ഞാൻ യഹോവ എന്നു നിങ്ങൾ അറിയും.11TSKCOMNjaan ningalil manushyareyum mrigangaleyum vardhippikkum; avar peruki santhaanapushtiyullavaraakum; njaan ningalil pandatheppole aale paarppikkum; ningalute aadikaalathundaayirunnathinekkaal adhikam nanma njaan ningalkku cheyyum; njaan yahova ennu ningal ariyum.11TSKCOMऔर मैं तुम पर मनुष्य और पशु दोनोंको बहुत बढ़ाऊंगा; और वे बढ़ेंगे और फूलें-फलेंगे; और मैं तुम को प्राचीनकाल की नाई बसाऊंगा, और पहिले से अधिक तुम्हारी भलाई करूंगा। तब तुम जान लोगे कि मैं यहोवा हूँ।12TSKCOMYea, I will cause men to walk upon you, even my people Israel; and they shall possess thee, and thou shalt be their inheritance, and thou shalt no more henceforth bereave them of men.12TSKCOMഞാൻ നിങ്ങളിൽ മനുഷ്യരെ, എന്റെ ജനമായ യിസ്രായേലിനെ തന്നേ, സഞ്ചരിക്കുമാറാക്കും; അവർ നിന്നെ കൈവശമാക്കും; നീ അവർക്കു അവകാശമായിരിക്കും; നീ അവരെ ഇനി മക്കളില്ലാത്തവരാക്കുകയുമില്ല.12TSKCOMNjaan ningalil manushyare, enre janamaaya yisraayeline thanne, sanjcharikkumaaraakkum; avar ninne kaivashamaakkum; nee avarkku avakaashamaayirikkum; nee avare ini makkalillaathavaraakkukayumilla.12TSKCOMऔर मैं ऐसा करूंगा कि मनुष्य अर्यत् मेरी प्रजा इस्राएल तुम पर चल-फिरेगी; और वे तुम्हारे स्वामी होंगे, और तुम उनका निज भाग होंगे, और वे फिर तुम्हारे कारण निर्वश न हो जाएंगे।13TSKCOMThus saith the Lord GOD; Because they say unto you, Thou land devourest up men, and hast bereaved thy nations;13TSKCOMയഹോവയായ കർത്താവു ഇപ്രകാരം അരുളിച്ചെയ്യുന്നു; അവർ നിന്നോടു: നീ മനുഷ്യരെ തിന്നുകളകയും നിന്റെ ജനത്തെ മക്കളില്ലാത്തവരാക്കുകയും ചെയ്ത ദേശമാകുന്നു എന്നു പറയുന്നതുകൊണ്ടു,13TSKCOMYahovayaaya karthaavu iprakaaram arulicheyyunnu; avar ninnotu: nee manushyare thinnukalakayum ninre janathe makkalillaathavaraakkukayum cheytha deshamaakunnu ennu parayunnathukontu,13TSKCOMपरमेश्वर यहोवा योंकहता हे, जो लोग तुम से कहा करते हैं, कि तू मनुष्योंका खानेवाला है, और अपके पर बसी हुई जाति को तिर्वश कर देता है,14TSKCOMTherefore thou shalt devour men no more, neither bereave thy nations any more, saith the Lord GOD.14TSKCOMനീ ഇനിമേൽ മനുഷ്യരെ തിന്നുകളകയില്ല; നിന്റെ ജനത്തെ മക്കളില്ലാത്തവരാക്കുകയുമില്ല; എന്നു യഹോവയായ കർത്താവിന്റെ അരുളപ്പാടു.14TSKCOMNee inimel manushyare thinnukalakayilla; ninre janathe makkalillaathavaraakkukayumilla; ennu yahovayaaya karthaavinre arulappaatu.14TSKCOMसो फिर तू मनुष्योंको न खएगा, और न अपके पर बसी हुई जाति को निर्वश करेगा, परमेश्वर यहोवा की यही वाणी है।15TSKCOMNeither will I cause men to hear in thee the shame of the heathen any more, neither shalt thou bear the reproach of the people any more, neither shalt thou cause thy nations to fall any more, saith the Lord GOD.15TSKCOMഞാൻ ഇനി നിന്നെ ജാതികളുടെ നിന്ദ കേൾപ്പിക്കയില്ല; വംശങ്ങളുടെ അപമാനം നീ ഇനി വഹിക്കയില്ല; നീ ഇനി നിന്റെ ജനത്തെ മക്കളില്ലാത്തവരാക്കുകയുമില്ല എന്നു യഹോവയായ കർത്താവിന്റെ അരുളപ്പാടു.15TSKCOMNjaan ini ninne jaathikalute ninda kelppikkayilla; vamshangalute apamaanam nee ini vahikkayilla; nee ini ninre janathe makkalillaathavaraakkukayumilla ennu yahovayaaya karthaavinre arulappaatu.15TSKCOMऔर मैं फिर जाति-जाति के लोगोंसे तेरी निन्दा न सुनवाऊंगा, और तुझे जाति-जाति की ओर से फिर नामधराई न सहनी पकेगी, और तुझ पर बसी हुई जाति को तू फिर ठोकर न खिलाएगा, परमेश्वर यहोवा की यही वाणी है।16TSKCOMMoreover the word of the LORD came unto me, saying,16TSKCOMയഹോവയുടെ അരുളപ്പാടു എനിക്കുണ്ടായതെന്തെന്നാൽ:16TSKCOMYahovayute arulappaatu enikkundaayathenthennaal:16TSKCOMफिर यहोवा का यह वचन मेरे पास पहुंचा,17TSKCOMSon of man, when the house of Israel dwelt in their own land, they defiled it by their own way and by their doings: their way was before me as the uncleanness of a removed woman.17TSKCOMമനുഷ്യപുത്രാ, യിസ്രായേൽ ഗൃഹം തങ്ങളുടെ ദേശത്തു പാർത്തിരുന്നപ്പോൾ, അവർ അതിനെ തങ്ങളുടെ നടപ്പുകൊണ്ടും പ്രവൃത്തികൾകൊണ്ടും മലിനമാക്കി; എന്റെ മുമ്പാകെ അവരുടെ നടപ്പു ഋതുവായോരു സ്ത്രീയുടെ മാലിന്യംപോലെ ആയിരുന്നു.17TSKCOMManushyaputhraa, yisraayel griham thangalute deshathu paarthirunnappol, avar athine thangalute natappukontum pravrithikalkontum malinamaakki; enre mumpaake avarute natappu rithuvaayoru sthreeyute maalinyampole aayirunnu.17TSKCOMहे मनुष्य के सन्तान, जब इस्राएल का घराना अपके देश में रहता या, तब अपक्की चालचलन और कामोंके द्वारा वे उसको अशुद्ध करते थे; उनकी चालचलन मुझे ऋतुमती की अशुद्धता सी जान पड़ती यी।18TSKCOMWherefore I poured my fury upon them for the blood that they had shed upon the land, and for their idols wherewith they had polluted it:18TSKCOMഅവർ ദേശത്തു ചൊരിഞ്ഞ രക്തംനിമിത്തവും അതിനെ തങ്ങളുടെ വിഗ്രഹങ്ങൾകൊണ്ടു മലിനമാക്കിയതുനിമിത്തവും ഞാൻ എന്റെ ക്രോധം അവരുടെമേൽ പകർന്നു.18TSKCOMAvar deshathu chorinjnja rakthamnimithavum athine thangalute vigrahangalkontu malinamaakkiyathunimithavum njaan enre krodham avarutemel pakarnnu.18TSKCOMसो जो हत्या उन्होंने देश में की, और देश को अपक्की मूरतोंके द्वारा अशुद्ध किया, इसके कारण मैं ने उन पर अपक्की जलजलाहट भड़काई।19TSKCOMAnd I scattered them among the heathen, and they were dispersed through the countries: according to their way and according to their doings I judged them.19TSKCOMഞാൻ അവരെ ജാതികളുടെ ഇടയിൽ ചിന്നിച്ചു; അവർ ദേശങ്ങളിൽ ചിതറിപ്പോയി; അവരുടെ നടപ്പിന്നും പ്രവൃത്തികൾക്കും തക്കവണ്ണം ഞാൻ അവരെ ന്യായം വിധിച്ചു.19TSKCOMNjaan avare jaathikalute itayil chinnichu; avar deshangalil chitharippoyi; avarute natappinnum pravrithikalkkum thakkavannam njaan avare nyaayam vidhichu.19TSKCOMऔर मैं ने उन्हें जाति-जाति में तितर-बितर किया, और वे देश देश में छितर गए; उनके चालचलन और कामोंके अनुसार मैं ने उनको दण्ड दिया।20TSKCOMAnd when they entered unto the heathen, whither they went, they profaned my holy name, when they said to them, These are the people of the LORD, and are gone forth out of his land.20TSKCOMഅവർ ജാതികളുടെ ഇടയിൽ ചെന്നുചേർന്നപ്പോൾ, ഇവർ യഹോവയുടെ ജനം, അവന്റെ ദേശം വിട്ടുപോകേണ്ടിവന്നവർ എന്നു അവർ അവരെക്കുറിച്ചു പറയുമാറാക്കിയതിനാൽ അവർ എന്റെ വിശുദ്ധനാമത്തെ അശുദ്ധമാക്കി.20TSKCOMAvar jaathikalute itayil chennuchernnappol, ivar yahovayute janam, avanre desham vittupokentivannavar ennu avar avarekkurichu parayumaaraakkiyathinaal avar enre vishudhanaamathe ashudhamaakki.20TSKCOMपरन्तु जब वे उन जातियोंमें पहुंचे जिन में वे पहुंचाए गए, तब उन्होंने मेरे पवित्र नाम को अपवित्र ठहराया, क्योंकि लोग उनके विषय में यह कहने लगे, थे यहोवा की प्रजा हैं, पर्रनतु उसके देश से निकाले गए हैं।21TSKCOMBut I had pity for mine holy name, which the house of Israel had profaned among the heathen, whither they went.21TSKCOMഎങ്കിലും യിസ്രായേൽഗൃഹം ചെന്നുചേർന്ന ജാതികളുടെ ഇടയിൽ അശുദ്ധമാക്കിയ എന്റെ വിശുദ്ധനാമത്തെക്കുറിച്ചു എനിക്കു അയ്യോഭാവം തോന്നി.21TSKCOMEngkilum yisraayelgriham chennuchernna jaathikalute itayil ashudhamaakkiya enre vishudhanaamathekkurichu enikku ayyobhaavam thonni.21TSKCOMपरन्तु मैं ने अपके पवित्र नाम की सुधि ली, जिसे इस्राएल के घराने ने उन जातियोंके बीच अपवित्र ठहराया या, जहां वे गए थे।22TSKCOMTherefore say unto the house of Israel, Thus saith the Lord GOD; I do not this for your sakes, O house of Israel, but for mine holy name’s sake, which ye have profaned among the heathen, whither ye went.22TSKCOMഅതുകൊണ്ടു നീ യിസ്രായേൽഗൃഹത്തോടു പറയേണ്ടതു: യഹോവയായ കർത്താവു ഇപ്രകാരം അരുളിച്ചെയ്യുന്നു: യിസ്രായേൽ ഗൃഹമേ, നിങ്ങളുടെ നിമിത്തമല്ല, നിങ്ങൾ ചെന്നുചേർന്ന ജാതികളുടെ ഇടയിൽ നിങ്ങൾ അശുദ്ധമാക്കിയിരിക്കുന്ന എന്റെ വിശുദ്ധ നാമംനിമിത്തം അത്രേ ഞാൻ അങ്ങനെ ചെയ്യുന്നതു.22TSKCOMAthukontu nee yisraayelgrihathotu parayendathu: yahovayaaya karthaavu iprakaaram arulicheyyunnu: yisraayel grihame, ningalute nimithamalla, ningal chennuchernna jaathikalute itayil ningal ashudhamaakkiyirikkunna enre vishudha naamamnimitham athre njaan angane cheyyunnathu.22TSKCOMइस कारण तू इस्राएल के घराने से कह, परमेश्वर यहोवा योंकहता है, हे इस्राएल के घराने, मैं इस को तुम्हारे निमित्त नहीं, परन्तु अपके पवित्र नाम के निमित्त करता हूँ जिसे तुम ने उन जातियोंमें अपवित्र ठहराया जहां तुम गए थे।23TSKCOMAnd I will sanctify my great name, which was profaned among the heathen, which ye have profaned in the midst of them; and the heathen shall know that I am the LORD, saith the Lord GOD, when I shall be sanctified in you before their eyes.23TSKCOMജാതികളുടെ ഇടയിൽ നിങ്ങൾ അശുദ്ധമാക്കിയതായി അവരുടെ ഇടയിൽ അശുദ്ധമായ്പോയിരിക്കുന്ന എന്റെ മഹത്തായ നാമത്തെ ഞാൻ വിശുദ്ധീകരിക്കും; ജാതികൾ കാൺകെ ഞാൻ എന്നെത്തന്നേ നിങ്ങളിൽ വിശുദ്ധീകരിക്കുമ്പോൾ ഞാൻ യഹോവ എന്നു അവർ അറിയും എന്നു യഹോവയായ കർത്താവിന്റെ അരുളപ്പാടു.23TSKCOMJaathikalute itayil ningal ashudhamaakkiyathaayi avarute itayil ashudhamaaypoyirikkunna enre mahathaaya naamathe njaan vishudheekarikkum; jaathikal kaanke njaan ennethanne ningalil vishudheekarikkumpol njaan yahova ennu avar ariyum ennu yahovayaaya karthaavinre arulappaatu.23TSKCOMऔर मैं अपके बड़े नाम को पवित्र ठहराऊंगा, जो जातियोंमें अपवित्र ठहराया गया, जिसे तुम ने उनके बीच अपवित्र किया; और जब मैं उनकी दृष्टि में तुम्हारे बीच पवित्र ठहरूंगा, तब वे जातियां जान लेगी कि मैं यहोवा हूँ, परमेश्वर यहोवा की यही वाणी है।24TSKCOMFor I will take you from among the heathen, and gather you out of all countries, and will bring you into your own land.24TSKCOMഞാൻ നിങ്ങളെ ജാതികളുടെ ഇടയിൽനിന്നു കൂട്ടി സകലദേശങ്ങളിൽനിന്നും നിങ്ങളെ ശേഖരിച്ചു സ്വന്തദേശത്തേക്കു വരുത്തും.24TSKCOMNjaan ningale jaathikalute itayilninnu kootti sakaladeshangalilninnum ningale shekharichu svanthadeshathekku varuthum.24TSKCOMमैं तुम को जातियोंमें से ले लूंगा, और देशोंमें से इकट्ठा करूंगा; और तुम को तुम्हारे निज देश में पहुंचा दूंगा।25TSKCOMThen will I sprinkle clean water upon you, and ye shall be clean: from all your filthiness, and from all your idols, will I cleanse you.25TSKCOMഞാൻ നിങ്ങളുടെമേൽ നിർമ്മലജലം തളിക്കും; നിങ്ങൾ നിർമ്മലരായി തീരും, ഞാൻ നിങ്ങളുടെ സകലമലിനതയെയും സകലവിഗ്രഹങ്ങളെയും നീക്കി നിങ്ങളെ നിർമ്മലീകരിക്കും.25TSKCOMNjaan ningalutemel nirmmalajalam thalikkum; ningal nirmmalaraayi theerum, njaan ningalute sakalamalinathayeyum sakalavigrahangaleyum neekki ningale nirmmaleekarikkum.25TSKCOMमैं तुम पर शुद्ध जल छिड़कूंगा, और तुम शुद्ध हो जाओगे; और मैं तुम को तुम्हारी सारी अशुद्धता और मूरतोंसे शुद्ध करूंगा।26TSKCOMA new heart also will I give you, and a new spirit will I put within you: and I will take away the stony heart out of your flesh, and I will give you an heart of flesh.26TSKCOMഞാൻ നിങ്ങൾക്കു പുതിയോരു ഹൃദയം തരും; പുതിയോരു ആത്മാവിനെ ഞാൻ നിങ്ങളുടെ ഉള്ളിൽ ആക്കും; കല്ലായുള്ള ഹൃദയം ഞാൻ നിങ്ങളുടെ ജഡത്തിൽനിന്നു നീക്കി മാംസമായുള്ള ഹൃദയം നിങ്ങൾക്കു തരും.26TSKCOMNjaan ningalkku puthiyoru hridayam tharum; puthiyoru aathmaavine njaan ningalute ullil aakkum; kallaayulla hridayam njaan ningalute jadathilninnu neekki maamsamaayulla hridayam ningalkku tharum.26TSKCOMमैं तुम को नया मन दूंगा, और तुम्हारे भीतर नई आत्मा उत्पन्न करूंगा; और तुम्हारी देह में से पत्यर का ह्रृदय निकालकर तुम को मांस का ह्रृदय दूंगा।27TSKCOMAnd I will put my spirit within you, and cause you to walk in my statutes, and ye shall keep my judgments, and do them.27TSKCOMഞാൻ എന്റെ ആത്മാവിനെ നിങ്ങളുടെ ഉള്ളിൽ ആക്കി നിങ്ങളെ എന്റെ ചട്ടങ്ങളിൽ നടക്കുമാറാക്കും; നിങ്ങൾ എന്റെ വിധികളെ പ്രമാണിച്ചു അനുഷ്ഠിക്കും.27TSKCOMNjaan enre aathmaavine ningalute ullil aakki ningale enre chattangalil natakkumaaraakkum; ningal enre vidhikale pramaanichu anushthikkum.27TSKCOMऔर मैं अपना आत्मा तुम्हारे भीतर देकर ऐसा करूंगा कि तुम मेरी विधियोंपर चलोगे और मेरे नियमोंको मानकर उनके अनुसार करोगे।28TSKCOMAnd ye shall dwell in the land that I gave to your fathers; and ye shall be my people, and I will be your God.28TSKCOMഞാൻ നിങ്ങളുടെ പിതാക്കന്മാർക്കു കൊടുത്ത ദേശത്തു നിങ്ങൾ പാർക്കും; നിങ്ങൾ എനിക്കു ജനമായും ഞാൻ നിങ്ങൾക്കു ദൈവമായും ഇരിക്കും.28TSKCOMNjaan ningalute pithaakkanmaarkku kotutha deshathu ningal paarkkum; ningal enikku janamaayum njaan ningalkku daivamaayum irikkum.28TSKCOMतुम उस देश में बसोगे जो मैं ने तुम्हारे पितरोंको दिया या; और तुम मेरी प्रजा ठहरोगे, और मैं तुम्हारा परमेश्वर ठहरूंगा।29TSKCOMI will also save you from all your uncleannesses: and I will call for the corn, and will increase it, and lay no famine upon you.29TSKCOMഞാൻ നിങ്ങളുടെ സകല മലിനതകളും നീക്കി നിങ്ങളെ രക്ഷിക്കും; ഞാൻ നിങ്ങളുടെമേൽ ക്ഷാമം വരുത്താതെ ധാന്യം വിളിച്ചുവരുത്തി വർദ്ധിപ്പിക്കും.29TSKCOMNjaan ningalute sakala malinathakalum neekki ningale rakshikkum; njaan ningalutemel kshaamam varuthaathe dhaanyam vilichuvaruthi vardhippikkum.29TSKCOMऔर मैं तुम को तुम्हारी सारी अशुद्धता से छुड़ाऊंगा, और अन्न उपजने की आज्ञा देकर, उसे बढ़ाऊंगा और तुम्हारे बीच अकाल न डालूंगा।30TSKCOMAnd I will multiply the fruit of the tree, and the increase of the field, that ye shall receive no more reproach of famine among the heathen.30TSKCOMനിങ്ങൾ ഇനിമേൽ ജാതികളുടെ ഇടയിൽ ക്ഷാമത്തിന്റെ നിന്ദ അനുഭവിക്കാതിരിക്കേണ്ടതിന്നു ഞാൻ വൃക്ഷങ്ങളുടെ ഫലവും നിലത്തിന്റെ വിളവും വർദ്ധിപ്പിക്കും.30TSKCOMNingal inimel jaathikalute itayil kshaamathinte ninda anubhavikkaathirikkendathinnu njaan vrikshangalute phalavum nilathinte vilavum vardhippikkum.30TSKCOMमैं वृझोंके फल और खेत की उपज बढ़ाऊंगा, कि जातियोंमें अकाल के कारण फिर तुम्हारी नामधराई न होगी।31TSKCOMThen shall ye remember your own evil ways, and your doings that were not good, and shall lothe yourselves in your own sight for your iniquities and for your abominations.31TSKCOMഅപ്പോൾ നിങ്ങൾ നിങ്ങളുടെ ദുർമ്മാർഗ്ഗങ്ങളെയും നന്നല്ലാത്ത പ്രവൃത്തികളെയും ഓർത്തു നിങ്ങളുടെ അകൃത്യങ്ങൾ നിമിത്തവും മ്ലേച്ഛതകൾ നിമിത്തവും നിങ്ങൾക്കു നിങ്ങളോടു തന്നേ വെറുപ്പു തോന്നും.31TSKCOMAppol ningal ningalute durmmaarggangaleyum nannallaatha pravrithikaleyum orthu ningalute akrithyangal nimithavum mlechhathakal nimithavum ningalkku ningalotu thanne veruppu thonnum.31TSKCOMतब तुम अपके बुरे चालचलन और अपके कामोंको जो अच्छे नहीं थे, स्मरण करके अपके अधर्म और घिनौने कामोंके कारण अपके आप से घृणा करोगे।32TSKCOMNot for your sakes do I this, saith the Lord GOD, be it known unto you: be ashamed and confounded for your own ways, O house of Israel.32TSKCOMനിങ്ങളുടെ നിമിത്തമല്ല ഞാൻ ഇതു ചെയ്യുന്നതു എന്നു നിങ്ങൾക്കു ബോധ്യമായിരിക്കട്ടെ എന്നു യഹോവയായ കർത്താവു അരുളിച്ചെയ്യുന്നു; യിസ്രായേൽഗൃഹമേ, നിങ്ങളുടെ നടപ്പുനിമിത്തം ലജ്ജിച്ചു നാണിപ്പിൻ.32TSKCOMNingalute nimithamalla njaan ithu cheyyunnathu ennu ningalkku bodhyamaayirikkatte ennu yahovayaaya karthaavu arulicheyyunnu; yisraayelgrihame, ningalute natappunimitham lajjichu naanippin.32TSKCOMपरमेश्वर यहोवा की यह वाणी है, तुम जान जो कि मैं इसको तुम्हारे निमित्त नहीं करता। हे इस्राएल के घराने अपके चालचलन के विषय में लज्जित हो और तुम्हारा मुख काला हो जाए।33TSKCOMThus saith the Lord GOD; In the day that I shall have cleansed you from all your iniquities I will also cause you to dwell in the cities, and the wastes shall be builded.33TSKCOMയഹോവയായ കർത്താവു ഇപ്രകാരം അരുളിച്ചെയ്യുന്നു: ഞാൻ നിങ്ങളുടെ അകൃത്യങ്ങളൊക്കെയും നീക്കി നിങ്ങളെ നിർമ്മലീകരിക്കുന്ന നാളിൽ നിങ്ങളുടെ പട്ടണങ്ങളിൽ ഞാൻ ആളെ പാർപ്പിക്കും; ശൂന്യസ്ഥലങ്ങളെയും പണിയും.33TSKCOMYahovayaaya karthaavu iprakaaram arulicheyyunnu: njaan ningalute akrithyangalokkeyum neekki ningale nirmmaleekarikkunna naalil ningalute pattanangalil njaan aale paarppikkum; shoonyasthalangaleyum paniyum.33TSKCOMपरमेश्वर यहोवा योंकहता है, जब मैं तुम को तुम्हारे सब अधर्म के कामोंसे शुद्ध करूंगा, तब तुम्हारे नगरोंको बसाऊंगा; और तुम्हारे खण्डहर फिर बनाए जाएंगे।34TSKCOMAnd the desolate land shall be tilled, whereas it lay desolate in the sight of all that passed by.34TSKCOMവഴിപോകുന്ന ഏവരുടെയും കാഴ്ചെക്കു ശൂന്യമായ്ക്കിടന്നിരുന്ന പ്രദേശത്തു കൃഷി നടക്കും.34TSKCOMVazhipokunna evaruteyum kaazhchekku shoonyamaaykkitannirunna pradeshathu krishi natakkum.34TSKCOMऔर तुम्हारा देश जो सब आने जानेवालोंके साम्हने उजाड़ है, वह उजाड़ होने की सन्ती जोता बोया जाएगा।35TSKCOMAnd they shall say, This land that was desolate is become like the garden of Eden; and the waste and desolate and ruined cities are become fenced, and are inhabited.35TSKCOMശൂന്യമായ്ക്കിടന്നിരുന്ന ദേശം ഏദെൻ തോട്ടം പോലെയായ്തീർന്നുവല്ലോ; പാഴും ശൂന്യവുമായി ഇടിഞ്ഞുകിടന്നിരുന്ന പട്ടണങ്ങൾ ഉറപ്പും നിവാസികളും ഉള്ളവ ആയിത്തീർന്നുവല്ലോ എന്നു അവർ പറയും.35TSKCOMShoonyamaaykkitannirunna desham eden thottam poleyaaytheernnuvallo; paazhum shoonyavumaayi itinjnjukitannirunna pattanangal urappum nivaasikalum ullava aayitheernnuvallo ennu avar parayum.35TSKCOMऔर लोग कहा करेंगे, यह देश जो उजाड़ या, सो एदेन की बारी सा हो गया, और जो नगर खण्डहर और उजाड़ हो गए और ढाए गए थे, सो गढ़वाले हुए, और बसाए गए हैं।36TSKCOMThen the heathen that are left round about you shall know that I the LORD build the ruined places, and plant that that was desolate: I the LORD have spoken it, and I will do it.36TSKCOMഇടിഞ്ഞുകിടന്നിരുന്ന പട്ടണങ്ങളെ യഹോവയായ ഞാൻ പണിതു, ശൂന്യപ്രദേശത്തു നടുതല വെച്ചുണ്ടാക്കി എന്നു നിങ്ങളുടെ ചുറ്റും ശേഷിച്ചിരിക്കുന്ന ജാതികൾ അന്നു അറിയും; യഹോവയായ ഞാൻ അരുളിച്ചെയ്തിരിക്കുന്നു; ഞാൻ നിവർത്തിക്കയും ചെയ്യും.36TSKCOMItinjnjukitannirunna pattanangale yahovayaaya njaan panithu, shoonyapradeshathu natuthala vechundaakki ennu ningalute churrum sheshichirikkunna jaathikal annu ariyum; yahovayaaya njaan arulicheythirikkunnu; njaan nivarthikkayum cheyyum.36TSKCOMतब जो जातियां तुम्हारे आस पास बची रहेंगी, सो जान लेंगी कि मुझ यहोवा ने ढाए हुए को फिर बनाया, और उजाड़ में पेड़ रोपे हैं, मुझ यहोवा ने यह कहा, और ऐसा ही करूंगा।37TSKCOMThus saith the Lord GOD; I will yet for this be enquired of by the house of Israel, to do it for them; I will increase them with men like a flock.37TSKCOMയഹോവയായ കർത്താവു ഇപ്രകാരം അരുളിച്ചെയ്യുന്നു: യിസ്രായേൽഗൃഹം എന്നോടു അപേക്ഷിച്ചിട്ടു ഞാൻ ഒന്നുകൂടെ ചെയ്യും: ഞാൻ അവർക്കു ആളുകളെ ആട്ടിൻ കൂട്ടത്തെപ്പോലെ വർദ്ധിപ്പിച്ചുകൊടുക്കും.37TSKCOMYahovayaaya karthaavu iprakaaram arulicheyyunnu: yisraayelgriham ennotu apekshichittu njaan onnukoote cheyyum: njaan avarkku aalukale aattin koottatheppole vardhippichukotukkum.37TSKCOMपरमेश्वर यहोवा योंकहता है, इस्राएल के घराने में फिर मुझ से बिनती की जाएगी कि मैं उनके लिथे यह करूं; अर्यात् मैं उन में मनुष्योंकी गिनती फोड़-बकरियोंकी नाई बढ़ाऊं।38TSKCOMAs the holy flock, as the flock of Jerusalem in her solemn feasts; so shall the waste cities be filled with flocks of men: and they shall know that I am the LORD.38TSKCOMശൂന്യമായ്പോയിരുന്ന പട്ടണങ്ങൾ വിശുദ്ധമായ ആട്ടിൻ കൂട്ടംപോലെ, ഉത്സവങ്ങളിൽ യെരൂശലേമിലെ ആട്ടിൻ കൂട്ടംപോലെ തന്നേ, മനുഷ്യരാകുന്ന ആട്ടിൻ കൂട്ടം കൊണ്ടു നിറയും; ഞാൻ യഹോവ എന്നു അവർ അറിയും.38TSKCOMShoonyamaaypoyirunna pattanangal vishudhamaaya aattin koottampole, uthsavangalil yerooshalemile aattin koottampole thanne, manushyaraakunna aattin koottam kontu nirayum; njaan yahova ennu avar ariyum.38TSKCOMजैसे पवित्र समयोंकी भेड़-बकरियां, अर्यात्नियत पवॉं के समय यरूशलेम में की भेड़-बकरियां अनगिनित होती हैं वैसे ही जो नगर अब खण्ढहर हैं वे अनगिनित मनुष्योंके फुण्डोंसे भर जाएंगे। तब वे जान लेंगे कि मैं यहोवा हूँ।